- EIF3S3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84870
- Human, Mouse, Rat
- Unconjugated
- EIF3S3, eIF3-gamma, eIF3-p40
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: QQQQKHQYQQ RRQQENMQRQ SRGEPPLPEE DLSKLFKPPQ PPARMDSLLI AGQINTYCQN IKEFTAQNLG KLFMAQALQE YNN
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- EIF3S3
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- eukaryotic translation initiation factor 3 subunit H
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Angiogenesis, Cancer
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
Specifications/Features
Available conjugates: Unconjugated